224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Prostate-specific antigen |
|---|
Gene and Protein Information
| Gene ID | 354 |
|---|---|
| Uniprot Accession IDs | P07288 C9JXH3 G3V0H4 G3XAE3 Q15096 Q16272 Q86TG8 Q8IXI4 PSA |
| Ensembl ID | ENSP00000314151 |
| Symbol | APS APS PSA hK3 KLK2A1 |
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
| Sequence | MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 493182 | KLK3 | kallikrein related peptidase 3 | 9598 | VGNC:11150 | Inparanoid, OMA |
| Macaque | 719444 | KLK3 | kallikrein 3 | 9544 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.