🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MED19

DescriptionMediator of RNA polymerase II transcription subunit 19

Gene and Protein Information

Gene ID219541
Uniprot Accession IDs A0JLT2 Q8IV02 Q8IZD1
Ensembl ID ENSP00000337340
Symbol LCMR1 LCMR1 DT2P1G7 MED19AS
FamilyBelongs to the Mediator complex subunit 19 family.
Sequence
MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451200MED19mediator complex subunit 199598VGNC:53068OMA, EggNOG
Macaque704421MED19mediator complex subunit 199544Inparanoid, OMA, EggNOG
Mouse381379Med19mediator complex subunit 1910090MGI:1914234Inparanoid, OMA, EggNOG
Rat311165Med19mediator complex subunit 1910116RGD:1311926Inparanoid, OMA, EggNOG
Dog612925MED19mediator complex subunit 199615VGNC:43128Inparanoid, OMA, EggNOG
Horse100066998MED19mediator complex subunit 199796VGNC:20077Inparanoid, OMA, EggNOG
Cow509245MED19mediator complex subunit 199913VGNC:31356Inparanoid, OMA, EggNOG
Pig100520359MED19mediator complex subunit 199823OMA, EggNOG
Opossum100022927MED19mediator complex subunit 1913616OMA, EggNOG
Chicken428854MED19mediator complex subunit 199031CGNC:5547Inparanoid, OMA, EggNOG
Anole lizard100556094med19mediator complex subunit 1928377Inparanoid, OMA, EggNOG
XenopusMED19mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600]8364OMA, EggNOG
Zebrafish445021med19bmediator complex subunit 19b7955ZDB-GENE-040727-4OMA, EggNOG
C. elegans175378mdt-19Mediator of RNA polymerase II transcription subunit 196239Inparanoid, OMA, EggNOG
Fruitfly39987MED19Mediator complex subunit 197227FBgn0036761Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.