224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Microtubule-associated protein RP/EB family member 1 |
|---|
Gene and Protein Information
| Gene ID | 22919 |
|---|---|
| Uniprot Accession IDs | Q15691 B2R6I7 E1P5M8 Q3KQS8 |
| Ensembl ID | ENSP00000364721 |
| Symbol | EB1 |
| Family | Belongs to the MAPRE family. |
| Sequence | MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746655 | MAPRE1 | microtubule associated protein RP/EB family member 1 | 9598 | VGNC:14259 | OMA, EggNOG |
| Mouse | 13589 | Mapre1 | microtubule-associated protein, RP/EB family, member 1 | 10090 | MGI:891995 | Inparanoid, OMA, EggNOG |
| Rat | 114764 | Mapre1 | microtubule-associated protein, RP/EB family, member 1 | 10116 | RGD:621781 | Inparanoid, OMA, EggNOG |
| Dog | 100685707 | MAPRE1 | microtubule associated protein RP/EB family member 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100053947 | MAPRE1 | microtubule associated protein RP/EB family member 1 | 9796 | VGNC:19970 | Inparanoid, OMA, EggNOG |
| Cow | 507845 | MAPRE1 | microtubule associated protein RP/EB family member 1 | 9913 | VGNC:31232 | OMA, EggNOG |
| Pig | 733687 | MAPRE1 | microtubule associated protein RP/EB family member 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100009758 | MAPRE1 | microtubule associated protein RP/EB family member 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 419288 | MAPRE1 | microtubule associated protein RP/EB family member 1 | 9031 | CGNC:50961 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100551639 | mapre1 | microtubule associated protein RP/EB family member 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 394720 | mapre1 | microtubule associated protein RP/EB family member 1 | 8364 | XB-GENE-974542 | Inparanoid, OMA, EggNOG |
| Zebrafish | 334728 | mapre1b | microtubule-associated protein, RP/EB family, member 1b | 7955 | ZDB-GENE-040426-2256 | Inparanoid, OMA |
| S.cerevisiae | 856736 | BIM1 | microtubule-binding protein BIM1 | 4932 | S000000818 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 1
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 1
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 1
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.