224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Myelin-oligodendrocyte glycoprotein |
|---|
Gene and Protein Information
| Gene ID | 4340 |
|---|---|
| Uniprot Accession IDs | Q16653 A6NDR4 A6NNJ9 A8MY31 B0UZR9 E9PGF0 F8W9D5 O00713 O00714 O00715 Q13054 Q13055 Q14855 Q29ZN8 Q56UY0 Q5JNX7 Q5JNY1 Q5JNY2 Q5JNY4 Q5SSB5 Q5SSB6 Q5STL9 Q5STM0 Q5STM1 Q5STM2 Q5STM5 Q5SUK5 Q5SUK7 Q5SUK8 Q5SUK9 Q5SUL0 Q5SUL1 Q8IYG5 Q92891 Q92892 Q92893 Q92894 Q92895 Q93053 Q96KU9 Q96KV0 Q96KV1 Q99605 |
| Ensembl ID | ENSP00000366095 |
| Symbol | BTN6 BTNL11 MOGIG2 NRCLP7 |
| Family | Belongs to the immunoglobulin superfamily. BTN/MOG family. |
| Sequence | MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.