E2F2

DescriptionTranscription factor E2F2

Gene and Protein Information

Gene ID1870
Uniprot Accession IDs Q14209 B2R9W1 Q7Z6H1 E2F-2
Ensembl ID ENSP00000355249
Symbol E2F-2
FamilyBelongs to the E2F/DP family.
Sequence
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469153E2F2E2F transcription factor 29598VGNC:525OMA, EggNOG
Macaque710200E2F2E2F transcription factor 29544Inparanoid, OMA
Mouse242705E2f2E2F transcription factor 210090MGI:1096341Inparanoid, OMA, EggNOG
Rat684111E2f2E2F transcription factor 210116RGD:1593939OMA, EggNOG
Dog100855664E2F2E2F transcription factor 29615VGNC:40164Inparanoid, OMA, EggNOG
Horse100057866E2F2E2F transcription factor 29796VGNC:17385Inparanoid, OMA, EggNOG
Cow617024E2F2E2F transcription factor 29913VGNC:54420Inparanoid, OMA, EggNOG
Opossum100009746E2F2E2F transcription factor 213616Inparanoid, OMA, EggNOG
Zebrafish568846si:ch211-160f23.5si:ch211-160f23.57955ZDB-GENE-030131-704OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.