224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Matrix metalloproteinase-26 |
|---|
Gene and Protein Information
| Gene ID | 56547 |
|---|---|
| Uniprot Accession IDs | Q9NRE1 Q3MJ78 Q9GZS2 Q9NR87 MMP-26 |
| Ensembl ID | ENSP00000369753 |
| Family | Belongs to the peptidase M10A family. |
| Sequence | MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450977 | MMP26 | matrix metallopeptidase 26 | 9598 | VGNC:1100 | OMA, EggNOG |
| Macaque | 574248 | MMP26 | matrix metallopeptidase 26 | 9544 | Inparanoid, OMA, EggNOG | |
| Dog | 610101 | MMP26 | matrix metallopeptidase 26 | 9615 | VGNC:43285 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.