224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Galectin-9 |
|---|
Gene and Protein Information
| Gene ID | 3965 |
|---|---|
| Uniprot Accession IDs | O00182 A7VJG6 F8W9W4 O14532 O75028 Q3B8N1 Q53FQ0 Q8WYQ7 Q9NQ58 Gal-9 |
| Ensembl ID | ENSP00000378856 |
| Symbol | HUAT LGALS9A |
| Sequence | MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454519 | LGALS9 | galectin 9 | 9598 | VGNC:12400 | OMA, EggNOG |
| Macaque | 100427967 | LGALS9 | galectin 9 | 9544 | OMA, EggNOG | |
| Mouse | 16859 | Lgals9 | lectin, galactose binding, soluble 9 | 10090 | MGI:109496 | OMA, EggNOG |
| Rat | 25476 | Lgals9 | galectin 9 | 10116 | RGD:3005 | OMA, EggNOG |
| Dog | 442861 | LGALS9 | galectin 9 | 9615 | OMA, EggNOG | |
| Cow | 510813 | LGALS9 | galectin 9 | 9913 | OMA, EggNOG | |
| Pig | 396972 | LGALS9 | galectin 9 | 9823 | OMA, EggNOG | |
| Anole lizard | 103280916 | LOC103280916 | galectin-9 | 28377 | OMA, EggNOG | |
| Xenopus | 100124899 | lgals9c | lectin, galactoside-binding, soluble, 9C | 8364 | XB-GENE-988896 | Inparanoid, OMA, EggNOG |
| Zebrafish | 327284 | lgals9l3 | lectin, galactoside-binding, soluble, 9 (galectin 9)-like 3 | 7955 | ZDB-GENE-040718-159 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.