224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Homeobox protein DLX-4 |
|---|
Gene and Protein Information
| Gene ID | 1748 |
|---|---|
| Uniprot Accession IDs | Q92988 D3DTX2 D3DTX3 O60480 Q13265 Q6PJK0 Q9HBE0 |
| Ensembl ID | ENSP00000240306 |
| Symbol | BP1 DLX7 DLX8 DLX9 BP1 DLX7 DLX8 DLX9 OFC15 |
| Family | Belongs to the distal-less homeobox family. |
| Sequence | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455109 | DLX4 | distal-less homeobox 4 | 9598 | VGNC:9260 | OMA, EggNOG |
| Macaque | DLX4 | distal-less homeobox 4 [Source:HGNC Symbol;Acc:HGNC:2917] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 13394 | Dlx4 | distal-less homeobox 4 | 10090 | MGI:94904 | Inparanoid, OMA, EggNOG |
| Rat | 303469 | Dlx4 | distal-less homeobox 4 | 10116 | RGD:1308744 | Inparanoid, OMA, EggNOG |
| Dog | 609214 | DLX4 | distal-less homeobox 4 | 9615 | VGNC:53207 | Inparanoid, EggNOG |
| Cow | 516030 | DLX4 | distal-less homeobox 4 | 9913 | VGNC:28100 | Inparanoid, OMA, EggNOG |
| Opossum | DLX4 | distal-less homeobox 4 [Source:HGNC Symbol;Acc:HGNC:2917] | 13616 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein DLX-4
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein DLX-4
protein / nucleic acid binding / DNA binding protein / Homeobox protein DLX-4
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein DLX-4
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein DLX-4
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein DLX-4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.