224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Ragulator complex protein LAMTOR5 |
|---|
Gene and Protein Information
| Gene ID | 10542 |
|---|---|
| Uniprot Accession IDs | O43504 Q6IBD8 |
| Ensembl ID | ENSP00000256644 |
| Symbol | HBXIP XIP XIP HBXIP |
| Family | Belongs to the LAMTOR5 family. |
| Sequence | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457120 | LAMTOR5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 9598 | VGNC:8351 | OMA, EggNOG |
| Mouse | 68576 | Lamtor5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 10090 | MGI:1915826 | Inparanoid, EggNOG |
| Rat | 295357 | Lamtor5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 10116 | RGD:1305005 | Inparanoid, EggNOG |
| Horse | 106783217 | LAMTOR5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 9796 | VGNC:19577 | Inparanoid, OMA, EggNOG |
| Cow | 516090 | LAMTOR5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100033089 | LAMTOR5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 419811 | LAMTOR5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 9031 | CGNC:250 | OMA, EggNOG |
| Anole lizard | 100564514 | lamtor5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100135168 | lamtor5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 8364 | XB-GENE-950195 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100333504 | lamtor5 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 | 7955 | ZDB-GENE-110411-193 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.