🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

LMO4

DescriptionLIM domain transcription factor LMO4

Gene and Protein Information

Gene ID8543
Uniprot Accession IDs P61968 D3DT23 O00158 O88894
Ensembl ID ENSP00000359575
Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737619LMO4LIM domain only 49598VGNC:11517OMA, EggNOG
Macaque712752LMO4LIM domain only 49544Inparanoid, OMA, EggNOG
Mouse16911Lmo4LIM domain only 410090MGI:109360Inparanoid, OMA, EggNOG
Rat362051Lmo4LIM domain only 410116RGD:1305670Inparanoid, OMA
Dog479962LMO4LIM domain only 49615VGNC:42724Inparanoid, OMA, EggNOG
Horse100052327LMO4LIM domain only 49796VGNC:19711Inparanoid, OMA, EggNOG
Cow614212LMO4LIM domain only 49913VGNC:30936Inparanoid, OMA, EggNOG
Pig100127155LMO4LIM domain only 49823Inparanoid, OMA, EggNOG
Opossum100010796LMO4LIM domain only 413616Inparanoid, OMA, EggNOG
Platypus100075084LMO4LIM domain only 49258Inparanoid, OMA, EggNOG
Chicken373901LMO4LIM domain only 49031CGNC:48949Inparanoid, OMA, EggNOG
Xenopus448304lmo4.1LIM domain only 4, gene 18364XB-GENE-971939Inparanoid, OMA, EggNOG
Zebrafish324849lmo4bLIM domain only 4b7955ZDB-GENE-030131-3570Inparanoid, OMA, EggNOG
Fruitfly34361CG5708CG5708 gene product from transcript CG5708-RC7227FBgn0032196Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.