LIPA

DescriptionLysosomal acid lipase/cholesteryl ester hydrolase

Gene and Protein Information

Gene ID3988
Uniprot Accession IDs P38571 B2RBH5 D3DR29 Q16529 Q53H21 Q5T074 Q5T771 Q96EJ0 Acid cholesteryl ester hydrolase
Ensembl ID ENSP00000337354
Symbol LAL CESD
FamilyBelongs to the AB hydrolase superfamily. Lipase family.
Sequence
MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp466150LIPAlipase A, lysosomal acid type9598VGNC:7847OMA, EggNOG
Mouse16889Lipalysosomal acid lipase A10090MGI:96789Inparanoid, OMA, EggNOG
Rat25055Lipalipase A, lysosomal acid type10116RGD:3008Inparanoid, OMA, EggNOG
Dog100856363LIPAlipase A, lysosomal acid type9615VGNC:42693Inparanoid, OMA, EggNOG
Horse100071626LIPAlipase A, lysosomal acid type9796VGNC:19685Inparanoid, OMA, EggNOG
Cow100125267LIPAlipase A, lysosomal acid type9913VGNC:30904Inparanoid, OMA, EggNOG
Pig100142668LIPAlipase A, lysosomal acid type9823Inparanoid, OMA, EggNOG
Chicken423789LIPAlipase A, lysosomal acid type9031CGNC:4801Inparanoid, OMA
Zebrafish406713lipflipase, gastric7955ZDB-GENE-040426-2737Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    serine protease    /    Lysosomal acid lipase/cholesteryl ester hydrolase
protein    /    hydrolase    /    lipase    /    Lysosomal acid lipase/cholesteryl ester hydrolase
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Lipase    /    Lysosomal acid lipase/cholesteryl ester hydrolase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.