224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Microtubule-associated protein RP/EB family member 3 |
|---|
Gene and Protein Information
| Gene ID | 22924 |
|---|---|
| Uniprot Accession IDs | Q9UPY8 B7WPK5 O00265 Q6FHB0 Q6FI15 Q9BZP7 Q9BZP8 |
| Ensembl ID | ENSP00000233121 |
| Symbol | EB3 RP3 EBF3 EBF3-S |
| Family | Belongs to the MAPRE family. |
| Sequence | MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 106992881 | MAPRE3 | microtubule associated protein RP/EB family member 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 100732 | Mapre3 | microtubule-associated protein, RP/EB family, member 3 | 10090 | MGI:2140967 | Inparanoid, OMA, EggNOG |
| Rat | 298848 | Mapre3 | microtubule-associated protein, RP/EB family, member 3 | 10116 | RGD:1359297 | Inparanoid, OMA, EggNOG |
| Dog | 475694 | MAPRE3 | microtubule associated protein RP/EB family member 3 | 9615 | VGNC:43011 | Inparanoid, OMA, EggNOG |
| Horse | 100629914 | MAPRE3 | microtubule associated protein RP/EB family member 3 | 9796 | OMA, EggNOG | |
| Horse | 100050599 | LOC100050599 | microtubule-associated protein RP/EB family member 3 | 9796 | Inparanoid, OMA | |
| Cow | 528839 | MAPRE3 | microtubule associated protein RP/EB family member 3 | 9913 | VGNC:31234 | Inparanoid, OMA, EggNOG |
| Pig | 100524857 | MAPRE3 | microtubule associated protein RP/EB family member 3 | 9823 | OMA, EggNOG | |
| Opossum | 100618640 | MAPRE3 | microtubule associated protein RP/EB family member 3 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100559494 | mapre3 | microtubule associated protein RP/EB family member 3 | 28377 | Inparanoid, OMA | |
| Zebrafish | 431717 | mapre3b | microtubule-associated protein, RP/EB family, member 3b | 7955 | ZDB-GENE-040704-6 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 3
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 3
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 3
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.