🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MT-CO2

DescriptionCytochrome c oxidase subunit 2

Gene and Protein Information

Gene ID4513
Uniprot Accession IDs P00403 Q37526
Ensembl ID ENSP00000354876
Symbol COII COX2 COXII MTCO2 COII MTCO2
FamilyBelongs to the cytochrome c oxidase subunit 2 family.
Sequence
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp807864MT-CO2mitochondrially encoded cytochrome c oxidase II9598VGNC:11715Inparanoid, OMA, EggNOG
Macaque2846628COX2cytochrome c oxidase subunit II9544OMA, EggNOG
Mouse17709mt-Co2mitochondrially encoded cytochrome c oxidase II10090MGI:102503Inparanoid, OMA, EggNOG
Rat26198Mt-co2mitochondrially encoded cytochrome c oxidase II10116RGD:621872Inparanoid, OMA, EggNOG
Dog804479MT-CO2mitochondrially encoded cytochrome c oxidase II9615VGNC:53137Inparanoid, OMA, EggNOG
Horse807845COX2cytochrome c oxidase subunit II9796Inparanoid, OMA, EggNOG
Cow3283880COX2cytochrome c oxidase subunit II9913Inparanoid, OMA, EggNOG
Pig808504COX2cytochrome c oxidase subunit II9823Inparanoid, OMA, EggNOG
Opossum3074663COX2cytochrome c oxidase subunit II13616OMA, EggNOG
Platypus808709COX2cytochrome c oxidase subunit II9258Inparanoid, EggNOG
Anole lizard6385975COX2cytochrome c oxidase subunit II28377Inparanoid, OMA, EggNOG
Xenopus3283495COX2cytochrome c oxidase subunit II8364Inparanoid, OMA
Zebrafish140540mt-co2cytochrome c oxidase II, mitochondrial7955ZDB-GENE-011205-15Inparanoid, OMA, EggNOG
C. elegans2565697COX2cytochrome c oxidase subunit II6239Inparanoid, OMA, EggNOG
Fruitfly19893535COX2cytochrome c oxidase subunit II7227FBgn0013675Inparanoid, EggNOG
S.cerevisiae854622COX2cytochrome c oxidase subunit 24932S000007281Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.