🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MMP16

DescriptionMatrix metalloproteinase-16

Gene and Protein Information

Gene ID4325
Uniprot Accession IDs P51512 B2RAN7 Q14824 Q52H48 MMP-16
Ensembl ID ENSP00000286614
Symbol C8orf57 MMPX2 MMP-X2 C8orf57 MT-MMP2 MT-MMP3 MT3-MMP
FamilyBelongs to the peptidase M10A family.
Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736322MMP16matrix metallopeptidase 169598VGNC:6570OMA, EggNOG
Macaque695120MMP16matrix metallopeptidase 169544Inparanoid, OMA, EggNOG
Mouse17389Mmp16matrix metallopeptidase 1610090MGI:1276107Inparanoid, OMA, EggNOG
Rat65205Mmp16matrix metallopeptidase 1610116RGD:620199Inparanoid, OMA, EggNOG
Dog487036MMP16matrix metallopeptidase 169615VGNC:43278Inparanoid, OMA
Horse100049862MMP16matrix metallopeptidase 169796VGNC:20226Inparanoid, OMA, EggNOG
Cow282886MMP16matrix metallopeptidase 169913VGNC:31521Inparanoid, OMA, EggNOG
Pig100153257MMP16matrix metallopeptidase 169823Inparanoid, OMA, EggNOG
Opossum100021706MMP16matrix metallopeptidase 1613616Inparanoid, OMA
Platypus100075102MMP16matrix metallopeptidase 169258Inparanoid, OMA, EggNOG
Anole lizard100551730mmp16matrix metallopeptidase 1628377Inparanoid, OMA, EggNOG
Xenopus548746mmp16matrix metallopeptidase 168364XB-GENE-1007177Inparanoid, OMA
Zebrafish572034mmp16bmatrix metallopeptidase 16b (membrane-inserted)7955ZDB-GENE-061009-22Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.