224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Galectin-4 |
|---|
Gene and Protein Information
| Gene ID | 3960 |
|---|---|
| Uniprot Accession IDs | P56470 Gal-4 |
| Ensembl ID | ENSP00000302100 |
| Symbol | GAL4 L36LBP |
| Sequence | MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456011 | LGALS4 | galectin 4 | 9598 | VGNC:10392 | OMA, EggNOG |
| Macaque | 694195 | LGALS4 | galectin 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16855 | Lgals4 | lectin, galactose binding, soluble 4 | 10090 | MGI:107536 | OMA, EggNOG |
| Rat | 25474 | Lgals4 | galectin 4 | 10116 | RGD:3003 | Inparanoid, OMA, EggNOG |
| Dog | 484521 | LGALS4 | galectin 4 | 9615 | VGNC:42649 | Inparanoid, OMA, EggNOG |
| Horse | 100064337 | LGALS4 | galectin 4 | 9796 | VGNC:19643 | Inparanoid, OMA, EggNOG |
| Cow | 614804 | LGALS4 | galectin 4 | 9913 | VGNC:30854 | Inparanoid, OMA, EggNOG |
| Pig | 397041 | LGALS4 | galectin 4 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100011146 | LGALS4 | galectin 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100567030 | lgals4 | galectin 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496937 | lgals4.1 | lectin, galactoside-binding, soluble, 4, gene 1 | 8364 | XB-GENE-992854 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.