🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NEK7

DescriptionSerine/threonine-protein kinase Nek7

Gene and Protein Information

Gene ID140609
Uniprot Accession IDs Q8TDX7 A6NGT8
Ensembl ID ENSP00000356355
FamilyBelongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
Sequence
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736415NEK7NIMA related kinase 79598VGNC:11557OMA, EggNOG
Macaque710464NEK7NIMA related kinase 79544Inparanoid, OMA, EggNOG
Mouse59125Nek7NIMA (never in mitosis gene a)-related expressed kinase 710090MGI:1890645Inparanoid, OMA, EggNOG
Rat360850Nek7NIMA-related kinase 710116RGD:1311160Inparanoid, OMA, EggNOG
Dog480008NEK7NIMA related kinase 79615VGNC:43734Inparanoid, OMA
Horse100061722NEK7NIMA related kinase 79796VGNC:20674Inparanoid, OMA
Cow781355NEK7NIMA related kinase 79913VGNC:31998Inparanoid, OMA
Opossum100026840NEK7NIMA related kinase 713616Inparanoid, OMA
Chicken424350NEK7NIMA related kinase 79031CGNC:1586Inparanoid, OMA
Anole lizard100561378nek7NIMA related kinase 728377Inparanoid, OMA
Xenopus780029nek7NIMA-related kinase 78364XB-GENE-962512Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.