🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ALOX15

DescriptionArachidonate 15-lipoxygenase

Gene and Protein Information

Gene ID246
Uniprot Accession IDs P16050 A8K2P4 B7ZA11 Q8N6R7 Q99657 15-LOX
Ensembl ID ENSP00000458832
Symbol LOG15 LOG15 12-LOX 15-LOX 15-LOX-1
FamilyBelongs to the lipoxygenase family.
Sequence
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp748294ALOX15arachidonate 15-lipoxygenase9598VGNC:9149OMA, EggNOG
Macaque709212ALOX15arachidonate 15-lipoxygenase9544Inparanoid, OMA, EggNOG
Mouse11687Alox15arachidonate 15-lipoxygenase10090MGI:87997Inparanoid, OMA, EggNOG
Rat81639Alox15arachidonate 15-lipoxygenase10116RGD:70493Inparanoid, OMA
Dog489458ALOX15arachidonate 15-lipoxygenase9615VGNC:37811Inparanoid, OMA, EggNOG
Cow282139ALOX15arachidonate 15-lipoxygenase9913VGNC:25843Inparanoid, OMA, EggNOG
PigALOX15arachidonate 15-lipoxygenase [Source:RefSeq peptide;Acc:NP_999096]9823OMA, EggNOG
Zebrafish322732alox12arachidonate 12-lipoxygenase7955ZDB-GENE-030131-1452Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxygenase    /    Arachidonate 15-lipoxygenase
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxygenase    /    Arachidonate 15-lipoxygenase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.