224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | U6 snRNA-associated Sm-like protein LSm2 |
|---|
Gene and Protein Information
| Gene ID | 57819 |
|---|---|
| Uniprot Accession IDs | Q9Y333 Q6FGG1 |
| Ensembl ID | ENSP00000364813 |
| Symbol | C6orf28 G7B G7B snRNP C6orf28 YBL026W |
| Family | Belongs to the snRNP Sm proteins family. |
| Sequence | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462569 | LSM2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 9598 | VGNC:12652 | OMA, EggNOG |
| Macaque | 715592 | LSM2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 27756 | Lsm2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 10090 | MGI:90676 | Inparanoid, OMA, EggNOG |
| Rat | 684148 | Lsm2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 10116 | RGD:1598536 | Inparanoid, OMA, EggNOG |
| Horse | LSM2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:HGNC Symbol;Acc:HGNC:13940] | 9796 | OMA, EggNOG | ||
| Cow | 538662 | LSM2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 9913 | VGNC:31054 | Inparanoid, OMA, EggNOG |
| Opossum | 100025239 | LSM2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | LSM2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:HGNC Symbol;Acc:HGNC:13940] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100566131 | lsm2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549156 | lsm2 | LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated | 8364 | XB-GENE-483861 | Inparanoid, OMA, EggNOG |
| Zebrafish | 57924 | smx5 | smx5 | 7955 | ZDB-GENE-000616-10 | Inparanoid, OMA |
| C. elegans | 179833 | gut-2 | hypothetical protein | 6239 | Inparanoid, OMA | |
| Fruitfly | 39408 | CG10418 | CG10418 gene product from transcript CG10418-RA | 7227 | FBgn0036277 | Inparanoid, EggNOG |
| S.cerevisiae | 852255 | LSM2 | Sm-like protein LSM2 | 4932 | S000000122 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / ribonucleoprotein / U6 snRNA-associated Sm-like protein LSm2
protein / nucleic acid binding / ribonucleoprotein / U6 snRNA-associated Sm-like protein LSm2
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Ribonucleoprotein / U6 snRNA-associated Sm-like protein LSm2
protein / Nucleic acid binding / RNA binding protein / Ribonucleoprotein / U6 snRNA-associated Sm-like protein LSm2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.