🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NEK6

DescriptionSerine/threonine-protein kinase Nek6

Gene and Protein Information

Gene ID10783
Uniprot Accession IDs Q9HC98 B7Z2D9 Q5TBG3 Q5TBG9 Q6FG86 Q6IAR3 Q96E83 Q9ULX2
Ensembl ID ENSP00000362702
Symbol SID6-1512
FamilyBelongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
Sequence
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737739NEK6NIMA related kinase 69598VGNC:13922OMA, EggNOG
Macaque100427402NEK6NIMA related kinase 69544Inparanoid, OMA, EggNOG
Mouse59126Nek6NIMA (never in mitosis gene a)-related expressed kinase 610090MGI:1891638Inparanoid, OMA, EggNOG
Rat360161Nek6NIMA-related kinase 610116RGD:727779Inparanoid, OMA, EggNOG
Dog609003NEK6NIMA related kinase 69615VGNC:43733Inparanoid, OMA
Horse100071002NEK6NIMA related kinase 69796VGNC:20673Inparanoid, OMA
Cow515816NEK6NIMA related kinase 69913VGNC:31997Inparanoid, OMA
Pig100514624NEK6NIMA related kinase 69823Inparanoid, OMA
Chicken417101NEK6NIMA related kinase 69031CGNC:759Inparanoid, OMA, EggNOG
Xenopus448328nek6NIMA-related kinase 68364XB-GENE-956751Inparanoid, OMA
C. elegans181398nekl-3Serine/threonine-protein kinase nekl-36239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.