224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Muscleblind-like protein 1 |
|---|
Gene and Protein Information
| Gene ID | 4154 |
|---|---|
| Uniprot Accession IDs | Q9NR56 E9PBW7 O43311 O43797 Q86UV8 Q86UV9 Q96P92 Q96RE3 |
| Ensembl ID | ENSP00000282486 |
| Symbol | EXP KIAA0428 MBNL EXP MBNL |
| Family | Belongs to the muscleblind family. |
| Sequence | MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460787 | MBNL1 | muscleblind like splicing regulator 1 | 9598 | VGNC:2039 | OMA, EggNOG |
| Macaque | 708735 | MBNL1 | muscleblind like splicing regulator 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 56758 | Mbnl1 | muscleblind like splicing factor 1 | 10090 | MGI:1928482 | Inparanoid, OMA, EggNOG |
| Rat | 282635 | Mbnl1 | muscleblind-like splicing regulator 1 | 10116 | RGD:628668 | Inparanoid, OMA, EggNOG |
| Dog | 477116 | MBNL1 | muscleblind like splicing regulator 1 | 9615 | VGNC:43057 | Inparanoid, OMA, EggNOG |
| Horse | 100050018 | MBNL1 | muscleblind like splicing regulator 1 | 9796 | VGNC:20014 | Inparanoid, OMA, EggNOG |
| Cow | 781653 | MBNL1 | muscleblind like splicing regulator 1 | 9913 | VGNC:31283 | Inparanoid, OMA, EggNOG |
| Pig | 100525306 | MBNL1 | muscleblind like splicing regulator 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012831 | MBNL1 | muscleblind like splicing regulator 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | MBNL1 | muscleblind like splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:6923] | 9258 | OMA, EggNOG | ||
| Xenopus | mbnl1 | muscleblind like splicing regulator 1 [Source:Xenbase;Acc:XB-GENE-6035557] | 8364 | OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.