🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MSRB3

DescriptionMethionine-R-sulfoxide reductase B3

Gene and Protein Information

Gene ID253827
Uniprot Accession IDs Q8IXL7 B4DR19 B7ZAQ0 Q6UXS2 MsrB3
Ensembl ID ENSP00000347324
Symbol DFNB74
FamilyBelongs to the MsrB Met sulfoxide reductase family.
Sequence
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp744605MSRB3methionine sulfoxide reductase B39598VGNC:13422OMA, EggNOG
Macaque717617MSRB3methionine sulfoxide reductase B39544Inparanoid, OMA, EggNOG
Mouse320183Msrb3methionine sulfoxide reductase B310090MGI:2443538Inparanoid, OMA, EggNOG
Rat680036Msrb3methionine sulfoxide reductase B310116RGD:1596851OMA, EggNOG
Dog608386MSRB3methionine sulfoxide reductase B39615VGNC:43451Inparanoid, OMA, EggNOG
HorseMSRB3methionine sulfoxide reductase B3 [Source:HGNC Symbol;Acc:HGNC:27375]9796OMA, EggNOG
Cow617849MSRB3methionine sulfoxide reductase B39913VGNC:54457Inparanoid, OMA, EggNOG
Pig100511693MSRB3methionine sulfoxide reductase B39823OMA, EggNOG
Platypus100079557MSRB3methionine sulfoxide reductase B39258OMA, EggNOG
Chicken417833MSRB3methionine sulfoxide reductase B39031CGNC:13069Inparanoid, OMA
Anole lizard100553315msrb3methionine sulfoxide reductase B328377Inparanoid, OMA, EggNOG
Zebrafish415184msrb3methionine sulfoxide reductase B37955ZDB-GENE-040625-74Inparanoid, OMA, EggNOG
Fruitfly41309SelRSelenoprotein R7227FBgn0267376Inparanoid, EggNOG
S.cerevisiae850324MXR2Mxr2p4932S000000538Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.