The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
MSMB Description Beta-microseminoprotein
Gene and Protein Information Gene ID 4477 Uniprot Accession IDs P08118 B1API6 P11999 Q13125 Q6IAY9 Q9UC59 Ensembl ID ENSP00000463092 Symbol PRSP MSP PSP IGBF MSPB PN44 PRPS HPC13 PSP57 PSP94 PSP-94 Family Belongs to the beta-microseminoprotein family. Sequence MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 747280 MSMB microseminoprotein beta 9598 VGNC:5532 OMA, EggNOG Macaque 709332 MSMB microseminoprotein beta 9544 Inparanoid, OMA, EggNOG Mouse 17695 Msmb beta-microseminoprotein 10090 MGI:97166 Inparanoid, OMA, EggNOG Rat 29311 Msmb microseminoprotein, beta 10116 RGD:3113 Inparanoid, OMA, EggNOG Horse 100629874 MSMB microseminoprotein beta 9796 VGNC:20389 Inparanoid, OMA Cow 616019 MSMB microseminoprotein beta 9913 VGNC:31700 Inparanoid, OMA Pig 396852 MSMB microseminoprotein beta 9823 Inparanoid, OMA Xenopus 100492612 msmb.1 microseminoprotein, beta-, gene 1 8364 XB-GENE-1018322 OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.