224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Melanocortin receptor 3 |
|---|
Gene and Protein Information
| Gene ID | 4159 |
|---|---|
| Uniprot Accession IDs | P41968 Q4KN27 Q9H517 MC3-R |
| Ensembl ID | ENSP00000243911 |
| Symbol | MC3 OB20 OQTL BMIQ9 MC3-R |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 17201 | Mc3r | melanocortin 3 receptor | 10090 | MGI:96929 | Inparanoid, OMA, EggNOG |
| Rat | 29310 | Mc3r | melanocortin 3 receptor | 10116 | RGD:3056 | Inparanoid, OMA, EggNOG |
| Horse | 100054477 | MC3R | melanocortin 3 receptor | 9796 | VGNC:20021 | Inparanoid, OMA, EggNOG |
| Cow | 505405 | MC3R | melanocortin 3 receptor | 9913 | VGNC:31294 | Inparanoid, OMA, EggNOG |
| Pig | 100141404 | MC3R | melanocortin 3 receptor | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | MC3R | melanocortin 3 receptor [Source:HGNC Symbol;Acc:HGNC:6931] | 13616 | Inparanoid, EggNOG | ||
| Platypus | MC3R | melanocortin 3 receptor [Source:HGNC Symbol;Acc:HGNC:6931] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100555674 | mc3r | melanocortin 3 receptor | 28377 | Inparanoid, OMA | |
| Zebrafish | 353153 | mc3r | melanocortin 3 receptor | 7955 | ZDB-GENE-030502-3 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Melanocortin receptor / Melanocortin receptor 3
protein / G-protein coupled receptor / Class A rhodopsin like / Melanocortin receptor / Melanocortin receptor 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.