🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CCNA1

DescriptionCyclin-A1

Gene and Protein Information

Gene ID8900
Uniprot Accession IDs P78396 B7Z7E3 Q5T3V0 Q5U0G2 Q8IY91
Ensembl ID ENSP00000255465
Symbol CT146
FamilyBelongs to the cyclin family. Cyclin AB subfamily.
Sequence
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467260CCNA1cyclin A19598VGNC:5046OMA, EggNOG
Macaque693797CCNA1cyclin A19544Inparanoid, OMA, EggNOG
Mouse12427Ccna1cyclin A110090MGI:108042Inparanoid, OMA, EggNOG
Rat295052Ccna1cyclin A110116RGD:1310639Inparanoid, OMA, EggNOG
Dog477302CCNA1cyclin A19615VGNC:38892Inparanoid, OMA, EggNOG
Horse100147188CCNA1cyclin A19796VGNC:16202Inparanoid, OMA, EggNOG
Cow521939CCNA1cyclin A19913VGNC:26956Inparanoid, OMA, EggNOG
Pig100156017CCNA1cyclin A19823Inparanoid, OMA, EggNOG
Opossum100027136CCNA1cyclin A113616Inparanoid, OMA, EggNOG
Platypus100080719CCNA1cyclin A19258Inparanoid, OMA, EggNOG
Chicken418901CCNA1cyclin A19031CGNC:12810Inparanoid, OMA
Anole lizard100558206ccna1cyclin A128377Inparanoid, OMA
Xenopus548993ccna1cyclin A18364XB-GENE-922387Inparanoid, OMA, EggNOG
Zebrafish404206ccna1cyclin A17955ZDB-GENE-040311-2Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase activator    /    Cyclin-A1
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Kinase activator    /    Cyclin-A1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.