🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

C1QBP

DescriptionComplement component 1 Q subcomponent-binding protein, mitochondrial

Gene and Protein Information

Gene ID708
Uniprot Accession IDs Q07021 Q2HXR8 Q9NNY8
Ensembl ID ENSP00000225698
Symbol GC1QBP HABP1 SF2P32 p32 HABP1 gC1qR GC1QBP SF2p32 gC1Q-R COXPD33 SF2AP32
FamilyBelongs to the MAM33 family.
Sequence
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp455252C1QBPcomplement C1q binding protein9598VGNC:9226OMA, EggNOG
Macaque711817C1QBPcomplement C1q binding protein9544OMA, EggNOG
Mouse12261C1qbpcomplement component 1, q subcomponent binding protein10090MGI:1194505Inparanoid, OMA, EggNOG
Rat29681C1qbpcomplement C1q binding protein10116RGD:2230Inparanoid, OMA, EggNOG
Dog489450C1QBPcomplement C1q binding protein9615VGNC:38578Inparanoid, OMA, EggNOG
Horse100072802C1QBPcomplement C1q binding protein9796VGNC:51386Inparanoid, OMA, EggNOG
Cow518321C1QBPcomplement C1q binding protein9913VGNC:26618Inparanoid, OMA, EggNOG
OpossumC1QBPcomplement C1q binding protein [Source:HGNC Symbol;Acc:HGNC:1243]13616Inparanoid, OMA, EggNOG
Chicken395538C1QBPcomplement C1q binding protein9031CGNC:1156Inparanoid, OMA, EggNOG
Anole lizard100552432c1qbpcomplement C1q binding protein28377Inparanoid, OMA, EggNOG
Xenopus100494551c1qbpcomplement component 1, q subcomponent binding protein8364XB-GENE-973232Inparanoid, OMA, EggNOG
Zebrafish334619c1qbpcomplement component 1, q subcomponent binding protein7955ZDB-GENE-050417-408OMA, EggNOG
C. elegans175441cri-3Conserved regulator of innate immunity protein 36239Inparanoid, OMA, EggNOG
Fruitfly37006P32CG6459 gene product from transcript CG6459-RA7227FBgn0034259Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.