224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cytochrome P450 11B2, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 1585 |
|---|---|
| Uniprot Accession IDs | P19099 B0ZBE4 Q16726 |
| Ensembl ID | ENSP00000325822 |
| Symbol | CPN2 ALDOS CYP11B CYP11BL CYPXIB2 P450C18 P-450C18 P450aldo |
| Family | Belongs to the cytochrome P450 family. |
| Sequence | MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 110115 | Cyp11b1 | cytochrome P450, family 11, subfamily b, polypeptide 1 | 10090 | MGI:88583 | OMA, EggNOG |
| Rat | Cyp11b2 | cytochrome P450, family 11, subfamily b, polypeptide 2 [Source:RGD Symbol;Acc:2454] | 10116 | OMA, EggNOG | ||
| Dog | 482071 | CYP11B2 | cytochrome P450, family 11, subfamily B, polypeptide 2 | 9615 | OMA, EggNOG | |
| Horse | 100063645 | LOC100063645 | cytochrome P450 11B1, mitochondrial-like | 9796 | OMA, EggNOG | |
| Cow | 787628 | LOC787628 | cytochrome P450 11B1, mitochondrial | 9913 | OMA, EggNOG | |
| Opossum | 100032885 | LOC100032885 | cytochrome P450 11B1, mitochondrial | 13616 | OMA, EggNOG | |
| Anole lizard | 100560890 | LOC100560890 | cytochrome P450 11B, mitochondrial | 28377 | OMA, EggNOG | |
| Zebrafish | 791124 | cyp11c1 | cytochrome P450, family 11, subfamily C, polypeptide 1 | 7955 | ZDB-GENE-070828-1 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.