CYP11B2

DescriptionCytochrome P450 11B2, mitochondrial

Gene and Protein Information

Gene ID1585
Uniprot Accession IDs P19099 B0ZBE4 Q16726
Ensembl ID ENSP00000325822
Symbol CPN2 ALDOS CYP11B CYP11BL CYPXIB2 P450C18 P-450C18 P450aldo
FamilyBelongs to the cytochrome P450 family.
Sequence
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse110115Cyp11b1cytochrome P450, family 11, subfamily b, polypeptide 110090MGI:88583OMA, EggNOG
RatCyp11b2cytochrome P450, family 11, subfamily b, polypeptide 2 [Source:RGD Symbol;Acc:2454]10116OMA, EggNOG
Dog482071CYP11B2cytochrome P450, family 11, subfamily B, polypeptide 29615OMA, EggNOG
Horse100063645LOC100063645cytochrome P450 11B1, mitochondrial-like9796OMA, EggNOG
Cow787628LOC787628cytochrome P450 11B1, mitochondrial9913OMA, EggNOG
Opossum100032885LOC100032885cytochrome P450 11B1, mitochondrial13616OMA, EggNOG
Anole lizard100560890LOC100560890cytochrome P450 11B, mitochondrial28377OMA, EggNOG
Zebrafish791124cyp11c1cytochrome P450, family 11, subfamily C, polypeptide 17955ZDB-GENE-070828-1OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.