🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DYNLT1

DescriptionDynein light chain Tctex-type 1

Gene and Protein Information

Gene ID6993
Uniprot Accession IDs P63172 Q15763 Q5VTU4
Ensembl ID ENSP00000356056
Symbol TCTEL1 TCTEX-1 TCTEX1 CW-1 TCTEL1 tctex-1
FamilyBelongs to the dynein light chain Tctex-type family.
Sequence
MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp463098DYNLT1dynein light chain Tctex-type 19598VGNC:8717OMA, EggNOG
Macaque106998065DYNLT1dynein light chain Tctex-type 19544OMA, EggNOG
Mouse21648Dynlt1bdynein light chain Tctex-type 1B10090MGI:98643Inparanoid, OMA
Mouse100040531Dynlt1fdynein light chain Tctex-type 1F10090MGI:3780996OMA, EggNOG
Rat83462Dynlt1dynein light chain Tctex-type 110116RGD:620261Inparanoid, OMA, EggNOG
Horse100059508DYNLT1dynein light chain Tctex-type 19796VGNC:17374OMA, EggNOG
Cow282380DYNLT1dynein light chain Tctex-type 19913Inparanoid, OMA, EggNOG
Opossum100027715DYNLT1dynein light chain Tctex-type 113616OMA, EggNOG
Platypus100084499DYNLT1dynein light chain Tctex-type 19258OMA, EggNOG
Chicken421660DYNLT1dynein light chain Tctex-type 19031CGNC:14053Inparanoid, OMA, EggNOG
Anole lizard100556758dynlt1dynein light chain Tctex-type 128377OMA, EggNOG
Zebrafish100318879si:dkey-148f10.4si:dkey-148f10.47955ZDB-GENE-060503-292Inparanoid, OMA, EggNOG
Fruitfly42199Dlc90FDynein light chain 90F7227FBgn0024432Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    microtubule family cytoskeletal protein    /    Dynein light chain Tctex-type 1
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Dynein light chain Tctex-type 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.