CBX7

DescriptionChromobox protein homolog 7

Gene and Protein Information

Gene ID23492
Uniprot Accession IDs O95931 Q86T17
Ensembl ID ENSP00000216133
Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp458843CBX7chromobox 79598VGNC:5239OMA, EggNOG
Macaque703056CBX7chromobox 79544Inparanoid, OMA
Dog481247CBX7chromobox 79615VGNC:38768Inparanoid, OMA
Cow525770CBX7chromobox 79913VGNC:26820Inparanoid, OMA
OpossumCBX7chromobox 7 [Source:HGNC Symbol;Acc:HGNC:1557]13616Inparanoid, OMA
Anole lizard100564588cbx7chromobox 728377Inparanoid, OMA
Xenopus448638cbx7chromobox 78364XB-GENE-942584Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 7

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.