224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Carbonic anhydrase 13 |
|---|
Gene and Protein Information
| Gene ID | 377677 |
|---|---|
| Uniprot Accession IDs | Q8N1Q1 |
| Ensembl ID | ENSP00000318912 |
| Symbol | CAXIII |
| Family | Belongs to the alpha-carbonic anhydrase family. |
| Sequence | MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 747299 | CA13 | carbonic anhydrase 13 | 9598 | VGNC:12000 | OMA, EggNOG |
| Mouse | 71934 | Car13 | carbonic anhydrase 13 | 10090 | MGI:1931322 | Inparanoid, OMA, EggNOG |
| Rat | 499566 | Car13 | carbonic anhydrase 13 | 10116 | RGD:1560453 | Inparanoid, OMA, EggNOG |
| Dog | 487030 | CA13 | carbonic anhydrase 13 | 9615 | VGNC:38608 | Inparanoid, OMA, EggNOG |
| Horse | CA13 | carbonic anhydrase 13 [Source:HGNC Symbol;Acc:HGNC:14914] | 9796 | OMA, EggNOG | ||
| Cow | 513850 | CA13 | carbonic anhydrase 13 | 9913 | VGNC:26651 | Inparanoid, OMA, EggNOG |
| Pig | 100152714 | LOC100152714 | carbonic anhydrase 13 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018677 | LOC100018677 | carbonic anhydrase 13 | 13616 | OMA, EggNOG | |
| Platypus | CA13 | carbonic anhydrase 13 [Source:HGNC Symbol;Acc:HGNC:14914] | 9258 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.