🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CA3

DescriptionCarbonic anhydrase 3

Gene and Protein Information

Gene ID761
Uniprot Accession IDs P07451 B2R867 B3KUC8 O60842
Ensembl ID ENSP00000285381
Symbol Car3 CAIII
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque703801CA3carbonic anhydrase 39544Inparanoid, OMA, EggNOG
Mouse12350Car3carbonic anhydrase 310090MGI:88270Inparanoid, OMA, EggNOG
Rat54232Car3carbonic anhydrase 310116RGD:2241Inparanoid, OMA, EggNOG
Dog487032CA3carbonic anhydrase 39615VGNC:38611Inparanoid, OMA, EggNOG
Horse100050125CA3carbonic anhydrase 39796VGNC:15964Inparanoid, OMA, EggNOG
Cow513212CA3carbonic anhydrase 39913VGNC:26653Inparanoid, OMA, EggNOG
Pig494016CA3carbonic anhydrase 39823Inparanoid, OMA, EggNOG
Opossum100018604CA3carbonic anhydrase 313616Inparanoid, OMA, EggNOG
PlatypusCA3carbonic anhydrase 3 [Source:HGNC Symbol;Acc:HGNC:1374]9258OMA, EggNOG
Xenopus100496328ca3carbonic anhydrase III8364XB-GENE-1007186OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.