224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Caspase-6 |
|---|
Gene and Protein Information
| Gene ID | 839 |
|---|---|
| Uniprot Accession IDs | P55212 Q9BQE7 CASP-6 |
| Ensembl ID | ENSP00000265164 |
| Symbol | MCH2 MCH2 |
| Family | Belongs to the peptidase C14A family. |
| Sequence | MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 698788 | CASP6 | caspase 6 | 9544 | OMA, EggNOG | |
| Mouse | 12368 | Casp6 | caspase 6 | 10090 | MGI:1312921 | Inparanoid, OMA, EggNOG |
| Rat | 83584 | Casp6 | caspase 6 | 10116 | RGD:70967 | Inparanoid, OMA |
| Dog | 487899 | CASP6 | caspase 6 | 9615 | Inparanoid, EggNOG | |
| Horse | 100072861 | CASP6 | caspase 6 | 9796 | VGNC:16069 | Inparanoid, OMA, EggNOG |
| Cow | 538409 | CASP6 | caspase 6 | 9913 | VGNC:26782 | Inparanoid, OMA, EggNOG |
| Pig | 100517293 | CASP6 | caspase 6 | 9823 | OMA, EggNOG | |
| Opossum | 100009858 | CASP6 | caspase 6 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CASP6 | caspase 6 [Source:HGNC Symbol;Acc:HGNC:1507] | 9258 | OMA, EggNOG | ||
| Chicken | 395477 | CASP6 | caspase 6 | 9031 | CGNC:9250 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564002 | casp6 | caspase 6 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496478 | casp6 | caspase 6 | 8364 | XB-GENE-482797 | Inparanoid, OMA, EggNOG |
| Zebrafish | 552927 | casp6 | caspase 6, apoptosis-related cysteine peptidase | 7955 | ZDB-GENE-030825-4 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / enzyme modulator / protease inhibitor / Caspase-6
protein / enzyme modulator / cysteine protease / Caspase-6
protein / enzyme modulator / protease / Caspase-6
protein / enzyme modulator / hydrolase / Caspase-6
protein / enzyme modulator / protease inhibitor / Caspase-6
protein / enzyme modulator / cysteine protease / Caspase-6
protein / enzyme modulator / protease / Caspase-6
protein / enzyme modulator / hydrolase / Caspase-6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.