CBX5

DescriptionChromobox protein homolog 5

Gene and Protein Information

Gene ID23468
Uniprot Accession IDs P45973 B2R8T9
Ensembl ID ENSP00000209875
Symbol HP1A HP1 HP1A HEL25
Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467011CBX5chromobox 59598VGNC:12873OMA, EggNOG
Macaque703477CBX5chromobox 59544Inparanoid, OMA
Mouse12419Cbx5chromobox 510090MGI:109372Inparanoid, OMA
Rat300266Cbx5chromobox 510116RGD:1306619Inparanoid, OMA
Dog477593CBX5chromobox 59615VGNC:38767Inparanoid, OMA
Horse100062404CBX5chromobox 59796VGNC:16099Inparanoid, OMA
Cow538885CBX5chromobox 59913VGNC:26818Inparanoid, OMA
Anole lizard100556370cbx5chromobox 528377Inparanoid, OMA
Xenopus394502cbx5chromobox 58364XB-GENE-972727Inparanoid, OMA
Zebrafish563396cbx5chromobox homolog 5 (HP1 alpha homolog, Drosophila)7955ZDB-GENE-030131-5553Inparanoid, OMA
C. elegans181450hpl-1HP1 Like (heterochromatin protein)6239Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 5

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.