BTLA

DescriptionB- and T-lymphocyte attenuator

Gene and Protein Information

Gene ID151888
Uniprot Accession IDs Q7Z6A9 Q3B831 Q3HS85 Q6ZNH9
Ensembl ID ENSP00000333919
Symbol BTLA1 CD272
Sequence
MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460584BTLAB and T lymphocyte associated9598VGNC:1749OMA, EggNOG
Macaque708202BTLAB and T lymphocyte associated9544Inparanoid, OMA, EggNOG
Mouse208154BtlaB and T lymphocyte associated10090MGI:2658978Inparanoid, OMA, EggNOG
Rat407756BtlaB and T lymphocyte associated10116RGD:1303280Inparanoid, OMA, EggNOG
Dog487975BTLAB and T lymphocyte associated9615VGNC:38561Inparanoid, OMA, EggNOG
Horse100071491BTLAB and T lymphocyte associated9796VGNC:15921Inparanoid, OMA, EggNOG
Cow531767BTLAB and T lymphocyte associated9913VGNC:26602OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.