C1orf43

DescriptionUncharacterized protein C1orf43

Gene and Protein Information

Gene ID25912
Uniprot Accession IDs Q9BWL3 A8K3G8 D3DV72 D3DV74 Q5M801 Q5VU73 Q5VU83 Q96HP7 Q9UFU2 Q9UGL7 Q9UGL8 Q9Y2R6
Ensembl ID ENSP00000357507
Symbol NICE3 NS5ATP4 NICE3 NICE-3 S863-3 HSPC012 NS5ATP4
Sequence
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469503C1H1orf43chromosome 1 C1orf43 homolog9598VGNC:4998OMA, EggNOG
Macaque716453C1H1orf43chromosome 1 open reading frame, human C1orf439544OMA, EggNOG
Mouse996504933434E20RikRIKEN cDNA 4933434E20 gene10090MGI:1914027Inparanoid, OMA, EggNOG
Rat361985LOC361985similar to NICE-310116RGD:1359625Inparanoid, OMA
DogC1orf43chromosome 1 open reading frame 43 [Source:HGNC Symbol;Acc:HGNC:29876]9615OMA, EggNOG
Horse100056786LOC100056786uncharacterized protein C1orf43 homolog9796OMA, EggNOG
Cow538459C3H1orf43chromosome 3 open reading frame, human C1orf439913Inparanoid, OMA, EggNOG
Opossum100015479C2H1orf43chromosome 2 open reading frame, human C1orf4313616OMA, EggNOG
Xenopus100145061c1orf43chromosome 1 open reading frame 438364XB-GENE-1009268OMA, EggNOG
Zebrafish562761zgc:123238zgc:1232387955ZDB-GENE-051023-3Inparanoid, OMA, EggNOG
Fruitfly36903CG6665CG6665 gene product from transcript CG6665-RC7227FBgn0034172Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.