🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CALB1

DescriptionCalbindin

Gene and Protein Information

Gene ID793
Uniprot Accession IDs P05937 B2R696 B7Z9J4
Ensembl ID ENSP00000265431
Symbol CAB27 CALB D-28K
FamilyBelongs to the calbindin family.
Sequence
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464279CALB1calbindin 19598VGNC:915OMA, EggNOG
Macaque677721CALB1calbindin9544Inparanoid, OMA, EggNOG
Mouse12307Calb1calbindin 110090MGI:88248Inparanoid, OMA, EggNOG
Rat83839Calb1calbindin 110116RGD:69340Inparanoid, OMA, EggNOG
Dog611334CALB1calbindin 19615VGNC:38660Inparanoid, OMA, EggNOG
Horse100034057CALB1calbindin 19796VGNC:16003Inparanoid, OMA, EggNOG
Cow539930CALB1calbindin 19913VGNC:26700Inparanoid, OMA, EggNOG
Pig100153645CALB1calbindin 19823Inparanoid, OMA, EggNOG
Opossum100021929CALB1calbindin 113616Inparanoid, OMA, EggNOG
Platypus100076843CALB1calbindin 19258Inparanoid, OMA, EggNOG
Anole lizard100567779calb1calbindin 128377Inparanoid, OMA, EggNOG
Xenopus780272calb1calbindin 18364XB-GENE-951983Inparanoid, OMA, EggNOG
Zebrafish100001650calb1calbindin 17955ZDB-GENE-030131-8107Inparanoid, OMA
Fruitfly36905Cbp53ECalbindin 53E7227FBgn0004580Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.