224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 |
|---|
Gene and Protein Information
| Gene ID | 664 |
|---|---|
| Uniprot Accession IDs | Q12983 O14620 Q96GP0 |
| Ensembl ID | ENSP00000357625 |
| Symbol | NIP3 NIP3 |
| Family | Belongs to the NIP3 family. |
| Sequence | MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450831 | BNIP3 | BCL2 interacting protein 3 | 9598 | VGNC:13046 | OMA, EggNOG |
| Macaque | 100426120 | BNIP3 | BCL2 interacting protein 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12176 | Bnip3 | BCL2/adenovirus E1B interacting protein 3 | 10090 | MGI:109326 | Inparanoid, OMA, EggNOG |
| Rat | 84480 | Bnip3 | BCL2 interacting protein 3 | 10116 | RGD:620800 | Inparanoid, OMA, EggNOG |
| Dog | 607408 | BNIP3 | BCL2 interacting protein 3 | 9615 | VGNC:38493 | Inparanoid, OMA, EggNOG |
| Horse | 100051673 | BNIP3 | BCL2 interacting protein 3 | 9796 | VGNC:15857 | Inparanoid, OMA, EggNOG |
| Cow | 615342 | BNIP3 | BCL2 interacting protein 3 | 9913 | VGNC:26533 | Inparanoid, OMA, EggNOG |
| Pig | 100624868 | BNIP3 | BCL2 interacting protein 3 | 9823 | OMA, EggNOG | |
| Chicken | 423971 | BNIP3 | BCL2 interacting protein 3 | 9031 | CGNC:7969 | Inparanoid, OMA, EggNOG |
| Anole lizard | 103278256 | bnip3 | BCL2 interacting protein 3 | 28377 | Inparanoid, EggNOG | |
| Xenopus | 548576 | bnip3 | BCL2/adenovirus E1B 19kDa interacting protein 3 | 8364 | XB-GENE-971175 | Inparanoid, OMA, EggNOG |
| Zebrafish | 336116 | bnip3 | BCL2 interacting protein 3 | 7955 | ZDB-GENE-030131-8060 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.