BMF

DescriptionBcl-2-modifying factor

Gene and Protein Information

Gene ID90427
Uniprot Accession IDs Q96LC9 Q2M396 Q6NT30 Q6NT56 Q6P9F6 Q7Z7D4 Q7Z7D5 Q9H7K7
Ensembl ID ENSP00000346697
FamilyBelongs to the Bcl-2 family.
Sequence
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp453323BMFBcl2 modifying factor9598VGNC:6460OMA, EggNOG
Macaque706239BMFBcl2 modifying factor9544Inparanoid, OMA, EggNOG
Mouse171543BmfBCL2 modifying factor10090MGI:2176433Inparanoid, OMA, EggNOG
Rat246142BmfBcl2 modifying factor10116RGD:628658Inparanoid, OMA
Dog607313BMFBcl2 modifying factor9615VGNC:38474Inparanoid, OMA, EggNOG
Horse100057359BMFBcl2 modifying factor9796VGNC:15843Inparanoid, OMA, EggNOG
Cow541141BMFBcl2 modifying factor9913VGNC:26513Inparanoid, OMA, EggNOG
Opossum100031831BMFBcl2 modifying factor13616Inparanoid, EggNOG
Chicken769140BMFBcl2 modifying factor9031CGNC:10799Inparanoid, OMA, EggNOG
Anole lizard100555155bmfBcl2 modifying factor28377Inparanoid, OMA, EggNOG
Xenopus100495515bmfBcl2 modifying factor8364XB-GENE-982389Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.