🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

BTF3L4

DescriptionTranscription factor BTF3 homolog 4

Gene and Protein Information

Gene ID91408
Uniprot Accession IDs Q96K17 B3KNJ1 D3DQ32 G3V1C6
Ensembl ID ENSP00000360664
FamilyBelongs to the NAC-beta family.
Sequence
MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456854BTF3L4basic transcription factor 3 like 49598VGNC:11735OMA, EggNOG
Mouse70533Btf3l4basic transcription factor 3-like 410090MGI:1915312Inparanoid, OMA, EggNOG
Rat366434Btf3l4basic transcription factor 3-like 410116RGD:1311774Inparanoid, OMA
Dog100687058BTF3L4basic transcription factor 3 like 49615VGNC:38557Inparanoid, OMA, EggNOG
Horse100050901BTF3L4basic transcription factor 3 like 49796VGNC:15918Inparanoid, OMA, EggNOG
Cow539753BTF3L4basic transcription factor 3 like 49913VGNC:26596Inparanoid, OMA, EggNOG
Opossum100019175BTF3L4basic transcription factor 3 like 413616OMA, EggNOG
Platypus100077312BTF3L4basic transcription factor 3 like 49258Inparanoid, OMA, EggNOG
Chicken424638BTF3L4basic transcription factor 3 like 49031CGNC:8026Inparanoid, OMA, EggNOG
Anole lizard100562283btf3l4basic transcription factor 3 like 428377Inparanoid, OMA, EggNOG
Xenopus496686btf3l4basic transcription factor 3-like 48364XB-GENE-948236Inparanoid, OMA, EggNOG
Zebrafish393667btf3l4basic transcription factor 3-like 47955ZDB-GENE-040426-1650Inparanoid, OMA
C. elegans174090icd-1Transcription factor BTF3 homolog6239OMA, EggNOG
S.cerevisiae856070EGD1Egd1p4932S000005958OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.