224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Protein BTG1 |
|---|
Gene and Protein Information
| Gene ID | 694 |
|---|---|
| Uniprot Accession IDs | P62324 P31607 |
| Ensembl ID | ENSP00000256015 |
| Symbol | APRO2 |
| Family | Belongs to the BTG family. |
| Sequence | MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 12226 | Btg1 | B cell translocation gene 1, anti-proliferative | 10090 | MGI:88215 | Inparanoid, OMA, EggNOG |
| Rat | 29618 | Btg1 | BTG anti-proliferation factor 1 | 10116 | RGD:2224 | Inparanoid, OMA, EggNOG |
| Dog | 100684605 | BTG1 | BTG anti-proliferation factor 1 | 9615 | VGNC:38558 | Inparanoid, OMA, EggNOG |
| Horse | BTG1 | BTG anti-proliferation factor 1 [Source:HGNC Symbol;Acc:HGNC:1130] | 9796 | OMA, EggNOG | ||
| Cow | 281032 | BTG1 | BTG anti-proliferation factor 1 | 9913 | VGNC:26597 | Inparanoid, OMA, EggNOG |
| Opossum | BTG1 | BTG anti-proliferation factor 1 [Source:HGNC Symbol;Acc:HGNC:1130] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 396295 | BTG1 | BTG anti-proliferation factor 1 | 9031 | CGNC:49739 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100561441 | btg1 | BTG anti-proliferation factor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394522 | btg1 | B-cell translocation gene 1, anti-proliferative | 8364 | XB-GENE-1002920 | Inparanoid, OMA, EggNOG |
| Zebrafish | 114432 | btg1 | B-cell translocation gene 1, anti-proliferative | 7955 | ZDB-GENE-010726-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.