224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Carbonic anhydrase-related protein |
|---|
Gene and Protein Information
| Gene ID | 767 |
|---|---|
| Uniprot Accession IDs | P35219 A8K0A5 B3KQZ7 Q32MY2 CARP |
| Ensembl ID | ENSP00000314407 |
| Symbol | CALS CALS CARP CA-RP CAMRQ3 CA-VIII |
| Family | Belongs to the alpha-carbonic anhydrase family. |
| Sequence | MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464196 | CA8 | carbonic anhydrase 8 | 9598 | VGNC:10215 | OMA, EggNOG |
| Macaque | 699005 | CA8 | carbonic anhydrase 8 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12319 | Car8 | carbonic anhydrase 8 | 10090 | MGI:88253 | Inparanoid, OMA, EggNOG |
| Rat | 297814 | Car8 | carbonic anhydrase 8 | 10116 | RGD:1304709 | Inparanoid, OMA, EggNOG |
| Dog | 486965 | CA8 | carbonic anhydrase 8 | 9615 | VGNC:38616 | Inparanoid, OMA, EggNOG |
| Horse | 100052678 | CA8 | carbonic anhydrase 8 | 9796 | VGNC:15967 | Inparanoid, OMA, EggNOG |
| Cow | 515918 | CA8 | carbonic anhydrase 8 | 9913 | VGNC:26658 | Inparanoid, OMA, EggNOG |
| Pig | 100157869 | CA8 | carbonic anhydrase 8 | 9823 | OMA, EggNOG | |
| Opossum | 100022166 | CA8 | carbonic anhydrase 8 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CA8 | carbonic anhydrase 8 [Source:HGNC Symbol;Acc:HGNC:1382] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100561632 | ca8 | carbonic anhydrase 8 | 28377 | Inparanoid, EggNOG | |
| Xenopus | 496646 | ca8 | carbonic anhydrase VIII | 8364 | XB-GENE-953676 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550233 | ca8 | carbonic anhydrase VIII | 7955 | ZDB-GENE-050417-26 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.