🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ANXA4

DescriptionAnnexin A4

Gene and Protein Information

Gene ID307
Uniprot Accession IDs P09525 B4DDF9 Q96F33 Q9BWK1
Ensembl ID ENSP00000377833
Symbol ANX4 ANX4 P32.5 PIG28 PP4-X ZAP36 PAP-II HEL-S-274
FamilyBelongs to the annexin family.
Sequence
MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp459542ANXA4annexin A49598VGNC:17OMA, EggNOG
Macaque701433ANXA4annexin A49544Inparanoid, OMA, EggNOG
Mouse11746Anxa4annexin A410090MGI:88030Inparanoid, OMA, EggNOG
Rat79124Anxa4annexin A410116RGD:621171Inparanoid, OMA, EggNOG
Dog606756ANXA4annexin A49615VGNC:37941Inparanoid, OMA, EggNOG
Horse100050657ANXA4annexin A49796VGNC:15363Inparanoid, OMA, EggNOG
Cow281625ANXA4annexin A49913VGNC:25966Inparanoid, OMA, EggNOG
Pig100312960ANXA4annexin A49823Inparanoid, OMA, EggNOG
Opossum100032716ANXA4annexin A413616Inparanoid, EggNOG
Xenopus548801anxa4annexin A48364XB-GENE-854498Inparanoid, OMA, EggNOG
Zebrafish353362anxa4annexin A47955ZDB-GENE-030707-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.