224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Histo-blood group ABO system transferase |
|---|
Gene and Protein Information
| Gene ID | 28 |
|---|---|
| Uniprot Accession IDs | P16442 B0JDB9 O14758 Q14490 Q53I57 Q6ISD4 Q6KFZ2 Q70V27 Q99484 Q99485 Q9NY01 Q9UQ68 Q9UQ69 |
| Ensembl ID | ENSP00000483018 |
| Symbol | GTB NAGAT A3GALNT A3GALT1 |
| Family | Belongs to the glycosyltransferase 6 family. |
| Sequence | MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450164 | ABO | ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) | 9598 | Inparanoid, OMA | |
| Macaque | 722252 | ABO | ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase | 9544 | Inparanoid, OMA | |
| Mouse | 80908 | Abo | ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase, transferase B, alpha 1-3-galactosyltransferase) | 10090 | MGI:2135738 | Inparanoid, OMA |
| Rat | 100301568 | Abo | ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase | 10116 | RGD:2307241 | Inparanoid, OMA |
| Cow | 515340 | ABO | ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase | 9913 | VGNC:25510 | Inparanoid, OMA |
| Xenopus | 549437 | abo | ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) | 8364 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transferase / glycosyltransferase / Histo-blood group ABO system transferase
protein / transferase / glycosyltransferase / Histo-blood group ABO system transferase
DTO Classes
protein / Enzyme / Transferase / Glycosyltransferase / Histo-blood group ABO system transferase
protein / Enzyme / Transferase / Glycosyltransferase / Histo-blood group ABO system transferase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.