🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

BAD

DescriptionBcl2-associated agonist of cell death

Gene and Protein Information

Gene ID572
Uniprot Accession IDs Q92934 O14803 Q6FH21 BAD
Ensembl ID ENSP00000378040
Symbol BBC6 BCL2L8 BBC2 BCL2L8
FamilyBelongs to the Bcl-2 family.
Sequence
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100615623BADBCL2 associated agonist of cell death9598VGNC:1614OMA, EggNOG
Macaque717740BADBCL2 associated agonist of cell death9544Inparanoid, OMA, EggNOG
Mouse12015BadBCL2-associated agonist of cell death10090MGI:1096330Inparanoid, OMA, EggNOG
Rat64639BadBCL2-associated agonist of cell death10116RGD:620103Inparanoid, OMA
Dog483763BADBCL2 associated agonist of cell death9615VGNC:38362Inparanoid, OMA, EggNOG
Horse100055447BADBCL2 associated agonist of cell death9796VGNC:15752Inparanoid, OMA, EggNOG
Cow615013BADBCL2 associated agonist of cell death9913VGNC:26404Inparanoid, OMA, EggNOG
Pig100521065BADBCL2 associated agonist of cell death9823OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.