🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

BCL2

DescriptionApoptosis regulator Bcl-2

Gene and Protein Information

Gene ID596
Uniprot Accession IDs P10415 C9JHD5 P10416 Q13842 Q16197
Ensembl ID ENSP00000381185
Symbol Bcl-2 PPP1R50
FamilyBelongs to the Bcl-2 family.
Sequence
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse12043Bcl2B cell leukemia/lymphoma 210090MGI:88138Inparanoid, OMA, EggNOG
Rat24224Bcl2BCL2, apoptosis regulator10116RGD:2199Inparanoid, OMA, EggNOG
Dog403416BCL2BCL2, apoptosis regulator9615VGNC:54274Inparanoid, OMA, EggNOG
Horse100050934BCL2BCL2, apoptosis regulator9796VGNC:15790Inparanoid, OMA, EggNOG
Cow281020BCL2BCL2, apoptosis regulator9913VGNC:26445Inparanoid, OMA, EggNOG
Opossum100016570BCL2BCL2, apoptosis regulator13616Inparanoid, OMA, EggNOG
Chicken396282BCL2BCL2, apoptosis regulator9031CGNC:9759Inparanoid, OMA, EggNOG
Anole lizard100564886LOC100564886apoptosis regulator Bcl-228377Inparanoid, OMA, EggNOG
Xenopus100485267bcl2B-cell CLL/lymphoma 28364XB-GENE-943008Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.