224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Bcl-2-like protein 12 |
|---|
Gene and Protein Information
| Gene ID | 83596 |
|---|---|
| Uniprot Accession IDs | Q9HB09 Q3SY11 Q3SY13 Q96I96 Q9HB08 Bcl2-L-12 |
| Ensembl ID | ENSP00000482218 |
| Symbol | BPR |
| Family | Belongs to the Bcl-2 family. |
| Sequence | MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456213 | BCL2L12 | BCL2 like 12 | 9598 | VGNC:6615 | OMA, EggNOG |
| Macaque | 718981 | BCL2L12 | BCL2 like 12 | 9544 | OMA, EggNOG | |
| Mouse | 75736 | Bcl2l12 | BCL2-like 12 (proline rich) | 10090 | MGI:1922986 | Inparanoid, OMA, EggNOG |
| Rat | 361567 | Bcl2l12 | BCL2 like 12 | 10116 | RGD:1307361 | Inparanoid, OMA, EggNOG |
| Dog | 100688537 | BCL2L12 | BCL2 like 12 | 9615 | VGNC:53525 | Inparanoid, OMA, EggNOG |
| Horse | 100055909 | BCL2L12 | BCL2 like 12 | 9796 | VGNC:15792 | Inparanoid, OMA, EggNOG |
| Cow | 533338 | BCL2L12 | BCL2 like 12 | 9913 | VGNC:26447 | Inparanoid, OMA, EggNOG |
| Pig | 100521559 | BCL2L12 | BCL2 like 12 | 9823 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.