🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

B2M

DescriptionBeta-2-microglobulin

Gene and Protein Information

Gene ID567
Uniprot Accession IDs P61769 P01884 Q540F8 Q6IAT8 Q9UCK0 Q9UD48 Q9UDF4
Ensembl ID ENSP00000452780
Symbol IMD43
FamilyBelongs to the beta-2-microglobulin family.
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp450170B2Mbeta-2-microglobulin9598VGNC:11825Inparanoid, OMA, EggNOG
Macaque712428B2Mbeta-2-microglobulin9544Inparanoid, OMA, EggNOG
Mouse12010B2mbeta-2 microglobulin10090MGI:88127Inparanoid, OMA, EggNOG
Rat24223B2mbeta-2 microglobulin10116RGD:2189Inparanoid, OMA, EggNOG
Dog100855741B2Mbeta-2-microglobulin9615VGNC:38331OMA, EggNOG
Horse100034203B2Mbeta-2-microglobulin9796VGNC:15722Inparanoid, OMA, EggNOG
Cow783680LOC783680beta-2-microglobulin9913OMA, EggNOG
PigB2MBeta-2-microglobulin [Source:UniProtKB/Swiss-Prot;Acc:Q07717]9823Inparanoid, OMA, EggNOG
Opossum554191B2Mbeta-2-microglobulin13616Inparanoid, EggNOG
Chicken414830B2Mbeta-2-microglobulin9031CGNC:1542Inparanoid, OMA, EggNOG
Anole lizard100560544b2mbeta-2-microglobulin28377OMA, EggNOG
Zebrafish30400b2mbeta-2-microglobulin7955ZDB-GENE-980526-88Inparanoid, OMA
Zebrafish791742b2mlbeta-2-microglobulin, like7955ZDB-GENE-040426-2136OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    defense/immunity protein    /    major histocompatibility complex antigen    /    Beta-2-microglobulin
DTO Classes
protein    /    Immune response    /    Major histocompatibility complex antigen    /    Beta-2-microglobulin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.