🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CLIC1

DescriptionChloride intracellular channel protein 1

Gene and Protein Information

Gene ID1192
Uniprot Accession IDs O00299 Q15089 Q502X1
Ensembl ID ENSP00000364935
Symbol G6 NCC27 G6 CL1C1 NCC27
FamilyBelongs to the chloride channel CLIC family.
Sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462564CLIC1chloride intracellular channel 19598VGNC:52009OMA, EggNOG
Macaque715446CLIC1chloride intracellular channel 19544Inparanoid, OMA
Mouse114584Clic1chloride intracellular channel 110090MGI:2148924Inparanoid, OMA
Rat406864Clic1chloride intracellular channel 110116RGD:1303043Inparanoid, OMA, EggNOG
Dog474847CLIC1chloride intracellular channel 19615Inparanoid, OMA, EggNOG
Horse100058853CLIC1chloride intracellular channel 19796OMA, EggNOG
Cow515646CLIC1chloride intracellular channel 19913VGNC:27439Inparanoid, OMA, EggNOG
Opossum100023436CLIC1chloride intracellular channel 113616Inparanoid, OMA, EggNOG
Anole lizard100566329clic1chloride intracellular channel 128377Inparanoid, OMA, EggNOG
Xenopus394484clic1chloride intracellular channel 18364XB-GENE-479419Inparanoid, OMA, EggNOG
Zebrafish324481clic1chloride intracellular channel 17955ZDB-GENE-030131-3202Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    Intracellular chloride channel (clic) family    /    Chloride intracellular channel protein 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.