224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | ATP-dependent Clp protease proteolytic subunit, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 8192 |
|---|---|
| Uniprot Accession IDs | Q16740 B2R4W5 |
| Ensembl ID | ENSP00000245816 |
| Symbol | DFNB81 PRLTS3 |
| Family | Belongs to the peptidase S14 family. |
| Sequence | MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455637 | CLPP | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 9598 | VGNC:2385 | OMA, EggNOG |
| Macaque | 699593 | CLPP | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 9544 | OMA, EggNOG | |
| Mouse | 53895 | Clpp | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 10090 | MGI:1858213 | Inparanoid, OMA, EggNOG |
| Rat | 301117 | Clpp | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 10116 | RGD:1588583 | Inparanoid, OMA, EggNOG |
| Dog | 611738 | CLPP | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 9615 | VGNC:39356 | Inparanoid, OMA, EggNOG |
| Horse | 100065472 | CLPP | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 9796 | VGNC:16630 | Inparanoid, OMA, EggNOG |
| Cow | 535981 | CLPP | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 9913 | VGNC:27459 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558657 | clpp | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100135748 | clpp | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 8364 | XB-GENE-969408 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553713 | clpp | caseinolytic mitochondrial matrix peptidase proteolytic subunit | 7955 | ZDB-GENE-030131-7860 | Inparanoid, OMA, EggNOG |
| C. elegans | 174594 | clpp-1 | ATP-dependent Clp protease proteolytic subunit 1, mitochondrial | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 34402 | CG5045 | CG5045 gene product from transcript CG5045-RB | 7227 | FBgn0032229 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.