224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Calcium-binding mitochondrial carrier protein Aralar2 |
|---|
Gene and Protein Information
| Gene ID | 10165 |
|---|---|
| Uniprot Accession IDs | Q9UJS0 O14566 O14575 Q546F9 Q9NZW1 Q9UNI7 |
| Ensembl ID | ENSP00000400101 |
| Symbol | ARALAR2 CTLN2 CITRIN ARALAR2 |
| Family | Belongs to the mitochondrial carrier (TC 2.A.29) family. |
| Sequence | MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTLAGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGTLPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472450 | SLC25A13 | solute carrier family 25 member 13 | 9598 | VGNC:8757 | OMA, EggNOG |
| Mouse | 50799 | Slc25a13 | solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 13 | 10090 | MGI:1354721 | Inparanoid, OMA, EggNOG |
| Rat | 362322 | Slc25a13 | solute carrier family 25 member 13 | 10116 | RGD:1565889 | Inparanoid, OMA, EggNOG |
| Dog | 610138 | SLC25A13 | solute carrier family 25 member 13 | 9615 | VGNC:46293 | Inparanoid, OMA |
| Horse | 100063046 | SLC25A13 | solute carrier family 25 member 13 | 9796 | VGNC:23092 | Inparanoid, OMA |
| Cow | 615470 | SLC25A13 | solute carrier family 25 member 13 | 9913 | VGNC:34744 | Inparanoid, OMA |
| Pig | 100524162 | SLC25A13 | solute carrier family 25 member 13 | 9823 | Inparanoid, OMA | |
| Chicken | 428427 | SLC25A13 | solute carrier family 25 member 13 | 9031 | CGNC:7395 | Inparanoid, OMA |
| Anole lizard | 100561177 | slc25a13 | solute carrier family 25 member 13 | 28377 | Inparanoid, OMA | |
| Xenopus | 100124779 | slc25a13 | solute carrier family 25 member 13 | 8364 | XB-GENE-1013331 | Inparanoid, OMA |
| Zebrafish | slc25a13 | solute carrier family 25 (aspartate/glutamate carrier), member 13 | 7955 | ZDB-GENE-080319-2 | Inparanoid, OMA | |
| C. elegans | 175242 | K02F3.2 | Probable calcium-binding mitochondrial carrier K02F3.2 | 6239 | Inparanoid, OMA | |
| Fruitfly | 43616 | aralar1 | CG2139 gene product from transcript CG2139-RC | 7227 | FBgn0028646 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial amino acid transporter subfamily / Calcium-binding mitochondrial carrier protein Aralar2
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial amino acid transporter subfamily / Calcium-binding mitochondrial carrier protein Aralar2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.