224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Bcl-2-like protein 2 |
|---|
Gene and Protein Information
| Gene ID | 599 |
|---|---|
| Uniprot Accession IDs | Q92843 A8K0F4 Q2M3U0 Q5U0H4 Bcl2-L-2 |
| Ensembl ID | ENSP00000250405 |
| Symbol | BCLW KIAA0271 BCLW BCL-W PPP1R51 BCL2-L-2 |
| Family | Belongs to the Bcl-2 family. |
| Sequence | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100611631 | BCL2L2 | BCL2 like 2 | 9598 | VGNC:12984 | OMA, EggNOG |
| Mouse | 12050 | Bcl2l2 | BCL2-like 2 | 10090 | MGI:108052 | Inparanoid, OMA, EggNOG |
| Rat | 60434 | Bcl2l2 | Bcl2-like 2 | 10116 | RGD:620717 | Inparanoid, OMA, EggNOG |
| Dog | 490611 | BCL2L2 | BCL2 like 2 | 9615 | Inparanoid, OMA | |
| Horse | 100055644 | BCL2L2 | BCL2 like 2 | 9796 | VGNC:50577 | Inparanoid, OMA, EggNOG |
| Cow | 767601 | BCL2L2 | BCL2 like 2 | 9913 | Inparanoid, OMA | |
| Xenopus | 496475 | bcl2l2 | BCL2-like 2 | 8364 | XB-GENE-992427 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.